PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010545871.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 226aa    MW: 24040.2 Da    PI: 10.536
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010545871.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.2e-1394138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r +  ++t+ q+ s+ qky
   XP_010545871.1  94 PWTEEEHMKFLLGLQKLGKGDWRGISRNFVVTKTPTQVASHAQKY 138
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.0E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129416.78786143IPR017930Myb domain
SuperFamilySSF466893.96E-1689142IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-1990141IPR006447Myb domain, plants
SMARTSM007173.3E-1091141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-1091138IPR009057Homeodomain-like
PfamPF002493.7E-1194138IPR001005SANT/Myb domain
CDDcd001672.17E-994139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCSS YNRTGVRLFG VQLDLPTASS PPPPPDSSAA MKKSFSMNSL  60
PAAFSSSSSS SASFSGYLSD GIAPTSPDRK KGVPWTEEEH MKFLLGLQKL GKGDWRGISR  120
NFVVTKTPTQ VASHAQKYFL RRATLHKKKR RASLFDMVSA DDVNGVGVWK HGLISPDLGY  180
DPSPNKTGSG SSGGGPDLEL KLTVLQSPQT NKGPSSSASL LVISVT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146150KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010545871.11e-165PREDICTED: transcription factor MYB1R1
TrEMBLV4LJV35e-86V4LJV3_EUTSA; Uncharacterized protein
STRINGscaffold_802240.15e-83(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54962747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.14e-69MYB_related family protein